
abduksjonABO-systemetABO-uforlikelighetabscessabsorpsjonabsorpsjonsfasenACTHadaptasjonadduksjonadeninadenosindifosfatadenosintrifosfatADHADPadrenalinadrenokortikotropt hormonakkomodasjonaksjonspotensialaktinaktiv transportakuttfaseproteineralbuminaldosteronalfareseptorerallelalveolammingamylaseanalsfinkteranatomiske bevegelseranatomiske plananatomiske retningsangivelserandrogenerangiografiankerforbindelserannulus fibrosusanteriorantidiuretisk hormonantigenantigen-bindingsseteantigenreseptorerantistoffantrumaortaaortaklaffenappendix vermiformisarachnoideaarterierarteriolediameterarteriolerarvastrocytterATPatrialt natriuretisk peptidatrioventrikulærklaffeneatrioventrikulærknutenauskultasjonautofagiautokrin reguleringautonom kontroll av hjertetautonome nervesystemetautosomal dominant arvegangautosomal recessiv arvegangAV-klaffeneAV-knutenB-cellerbakteriemibalanittbarriereforsvarbasalganglierbasalmembranenbasebasilarmembranenbegercellerbeinmargbeinvevbeta-1-reseptorerbeta-2-reseptorerbetennelsesreaksjonbihulenebikuspidalklaffenbindevevbinyrebarkenbinyremargenbinyrenebiotilgjengelighetbitestikleneblindtarmblodblod-hjerne-barrierenblodcellerblodplatehemmerblodplaterblodsukkerblodtransfusjonblodtrykkblodtrykksrefleksenblodtrykksreguleringblæretransportBrocas senterbruskforbindelserbruskvevbrystmelkbrystmusklerbuegangenebukspyttbukspyttkjertelenbulbus olfactoriusbursacanales semicircularescellecelledelingcelleforbindelsercellekjernecellekommunikasjoncellemembranencelleåndingcerebrospinalvæskechorioideacircumflexCNScochleacollumcollum femoriscoloncorneacorpuscorpus ciliarecorpus vitreumcortex cerebriCSFcupulaCushings triade (hodeskade)cyanosecytokinercytokinstormcytoplasmacytosincytoskjelettetcytosolcytotoksiske cellercøkumD-dimerdefekasjonsprosessden blinde flekkden gule flekkendendritterdeoksyribonukleinsyredepolariseringdermatomdesmosomerdet cortiske organdiafragmadialysediapedesediastolediencefalondiffusjondiploide cellerdisakkariderDNAdopaminductus semicircularesduodenumdura materdyspnédødvolumEDVEFeffektorejeksjonsfraksjonEKGeksaserbasjoneksentrisk arbeideksitatoriske synapserekskresjoneksocytoseeksonekspektoratekspirasjonekspiratorisk reservevolumekstensjoneksternaelektrisk gradientelektrontransportkjedenemulgatorendediastolisk volumendesystolisk volumendetarmendocytoseendokardendokrin reguleringendokrine cellerendokrine pancreasendokrine systemendolymfeendomysiumenhancereenteriske nervesystemetependymcellerepigastrietepiglottisepilepsiepimysiumepitelvevEPOerektil dysfunksjonerytrocytterytropoieseerytropoietinESVfagocytosefagocytterfeberfenotypefettfettvevFEV1fibrinolysefibrøse forbindelserfimoseflebittfleksjonflerumettet fettfollikkelstimulerende hormonforankringsproteinerfordøyelseskanalenforkalkningforlengede margforsert ekspiratorisk volum1fosfolipiderfotonerFrank-Starlings hjertelovfrontalbarkfrontallappenFSHfundusfyllingsgradførstepassasjemetabolismegallegalleblæragallesaltergangliongap junctionsgassutvekslinggastringenetikkgenotypeghrelinglandelglatt muskulaturgliacellerglideleddglobinglottisglukagonglukoseGLUT4glykogenolysegonadergrå substansguaningynekomastihalveringstidhaploide cellerhaustrahCGhemoglobinhemoglobinets metningskurvehemostasehengselleddHennemans prinsippheterozygothilus-områdethippocampushis’ bunthjernebarkenhjernebjelkenhjernebroenhjernehalvdelerhjernehinnenehjernenervenehjernestammenhjertekontraksjonhjertemuskulaturhjertethjertets egenfrekvenshjertets elektriske ledningssystemhjertets hvilerytmehomeostasehomozygothormonell reguleringhormonsystemethornhinnenHRRhukommelsehukommelsescellerhvilemembranpotensialethvit substanshvite blodcellerhydrocele hydrolaserhyperpolariseringhypertermihyperton løsninghypofysenhypospadihypothalamushypoton løsninghørselsansenileumimmunimmuniseringimmunitetindre øretinfeksjoninflammasjoninhibitoriske synapserinspirasjoninspiratorisk reservevoluminsulininterferonerinterleukinerintermediære filamenterintimaintronionekanaleririsisometrisk arbeidisotone løsningjernkalsifikasjonkalsitriolkapillærerkarbohydraterkardiakarkontraksjonkatekolaminketoacidosekjemisk gradientkjemokinerkjemotaksekjønnsbundet arvegangkjønnscellerkjønnshormonerklitoriskneleddetknoklerkoagulasjonkodonkolecystokininkolskomplementfaktorerkomplementsystemetkomplementære baserkondylleddkonjugeringkonsentrisk arbeidkontraksjonkontraktilitetkontraktilt vevkoronararterienekorpuskortisolkromosomkromosomfeilkrøskuleleddkvinnelige kjønnshormonerkymotrypsinLADlangerhanske øycellerlangsynthetlarynxlateralLCXleddleddbruskleddkapselleddspalteleft anterior descendinglemniscus medialisleptinleukocytterleverlichen sclerosusligandlikevektsorganenelikevektsreseptorerlikevektssansenlillehjernenlipaselipolyseluktecelleluktehårluktekolbenluktenervenluktesansenlungekretsløpetlungenelungevolumluteiniserende hormonlymfatiske organerlymfelymfekarlymfeknuterlymfesystemetlymfocytterlymfoid rekkelymfoide organerlysozymmakrofagermarghulemastcellermediamedialmediastinummedulla oblongatamegakaryocyttermeiosemelatoninmelenamellomhjernenmellomøretmeniskmenstruasjonssyklusmesencefalonmessenger-RNAmettet fettMHC-molekylermidthjernenmikrogliamikrotottermikrotubulimikrovillimiltminuttvolummitokondriell arvegangmitokondriermitosemonosakkaridermotilitetmotorisk barkmotorisk funksjonmotoriske enhetermotoriske systemetmotorproteinmRNAmucinproduserende cellermuskarin-reseptorermuskel-vene-pumpenmuskelfiberbuntermuskelkontraksjonmuskelproteinermuskelvevmutasjonermyelinmyeliniserte aksonermyelogen rekkemyokardmyosinmyotomnatrium-kaliumpumpenaturlig drepercellenefronnegativ feedbacknerveimpulsnerveledningnerverotnervestyrt reguleringnervesystemetnervevevnervus vagusnetthinnennevroendokrin reguleringnevromuskulær synapsenevronnevrotransmitterNK-cellenoradrenalinnukleotidnærsynthetnøytrofile granulocytteroksidativ fosforyleringoksipitallappenoksygenmetningoksytocinoligodendrocyttomega-3-fettsyrerorganellerosmoseosmotisk trykkotolittorganeneoverflatespenningpancreaspapelparafimoseparakrin reguleringparasympatikusparathyreoideaparathyreoideahormonparietalcellerparietallappenpartialtrykkpassiv transportpenispenisfrakturperfusjonperifere nervesystemperikardperimysiumperiostperistaltikkperitonealdialyseperitoneumPeritubulær kapillærperkusjonpharynxpia materpivotleddplasmaplasmacellerplasmaproteinerplateepitelplatepluggdannelsepleuraplexus choroideuspnspolysakkariderponsportvenenpost-transkripsjonell modifikasjonposteriorpostsynaptisk membranpre-mRNApreloadpresynaptisk membranpriapismeprimæraktiv transportprimærresponsproenzymerprogesteronprolaktinpronasjonpropriosepsjonssansprostataproteaserproteinproteinfilamenterprovoserte krampeanfallpulmonalklaffenpunktmutasjonpupillenpurkinjefibrepusspylorusRanviersk innsnøringrefleksrefleksbuereflekssenterrefraktærperioderegnbuehinnenrektumreninrepolariseringreseptive feltreseptorproteinerrespirasjonsmusklerrespirasjonsreguleringrespirasjonssenteretrespiratorisk epitelrestvolumretikulocytterretinaretrograd bølgeRh-immuniseringrhesussystemetRNA-polymeraserotasjonsbevegelserryggmargenryggsøylenryggvirvlerrøde blodcellerrørknokkelsacculussadelleddsaltersarkolemmasarkomersatellittcellerSchwannske cellersclerascrotumsegmenteringsbevegelserseilklaffenesekresjonsekretinsekundæraktiv transportsekundærresponssemilunar-klaffenesemipermeabel membransenehinnesensorisk barksensoriske reseptorersensoriske systemsentralfurensentralnervesystemetsepsissignaloverføringsilenceresirkulasjonsreguleringsirkulasjonssystemetsitronsyresyklusenskjelettetskjoldbruskkjertelenslagvolumsmakskvalitetersmaksløkersmaksporersmakssansensmertesneglehusetSNOPPspenningshodepinespenningsstyrte kalsiumkanalerspenningsstyrte kanalerspesifikke immunforsvaretspinalganglionspinalnerversporstofferspråkforståelsespråkproduksjonspyttkjertlerstamcellerstarlingmekanismenstaversteroiderstimulusstorhjernenstrålelegemetstøttevevsubaraknoidalrommetsupinasjonsurfaktantSVsylinderepitelsympatikussymptomsynapsersynapsespaltesynovialleddsynsbanenesynsbarksynsfeltsynsnervensynsreseptorersystemkretsløpetsystolesædblærersædcellerT-angrepscelleT-hjelpecelletaeniaetakypnetappertarmfoldertarmtottertemporal rekrutteringtemporallappentestiklenetestisretensjontestistorsjontestosteronthalamusthyminthyreoideathyreoideastimulerende hormontidevolumtight junctionstilbaketrekningsreflekstinningbeinettotal lungekapasitettotal perifer motstandTPMtracheatractus spinothalamicustransduksjontranskripsjontranslasjontransmittersubstanstransportproteinertriglyseridertrikuspidalklaffentriptanertRNAtrombocyttertrommehinnentropomyosintroponintrypsintunica adventitiatunica intimatunica mediatverrstripet muskulaturtykktarmentynntarmentyroksintømmingsgradumettet fetturacilureaureterutriculusuveavaksinevaskulittvasopressinveksthormonveneklaffvenervenesinusvenolerventilasjonventrikkelventrikkelsystemetvestibulumvevvibrasjonssansvilliVirchows triadevirvellegemevitalkapasitetvitamin DvitaminervulvaWernickes områdeWillis’ sirkelytre øretZ-skivezona fasciculatazona glomerulosazona reticularisårehinnenøretøretrompetenøsofagusøstrogenøyemuskleneøyets lysbrytende medier


Lymfocytter (en type hvite blodceller) i immunsystemet. B-celler kan ved kontakt med et antigen utvikles til plasmaceller som produserer antistoff, og hukommelsesceller som er viktig for seinere immunitet.