
abduksjonABO-systemetABO-uforlikelighetabscessabsorpsjonabsorpsjonsfasenACTHadaptasjonadduksjonadeninadenosindifosfatadenosintrifosfatADHADPadrenalinadrenokortikotropt hormonakkomodasjonaksjonspotensialaktinaktiv transportakuttfaseproteineralbuminaldosteronalfareseptorerallelalveolammingamylaseanalsfinkteranatomiske bevegelseranatomiske plananatomiske retningsangivelserandrogenerankerforbindelserannulus fibrosusanteriorantidiuretisk hormonantigenantigen-bindingsseteantigenreseptorerantistoffantrumaortaaortaklaffenappendix vermiformisarachnoideaarterierarteriolediameterarteriolerarvastrocytterATPatrialt natriuretisk peptidatrioventrikulærklaffeneatrioventrikulærknutenauskultasjonautofagiautokrin reguleringautonom kontroll av hjertetautonome nervesystemetautosomal dominant arvegangautosomal recessiv arvegangAV-klaffeneAV-knutenB-cellerbakteriemibarriereforsvarbasalganglierbasalmembranenbasebasilarmembranenbegercellerbeinmargbeinvevbeta-1-reseptorerbeta-2-reseptorerbetennelsesreaksjonbihulenebikuspidalklaffenbindevevbinyrebarkenbinyremargenbinyrenebiotilgjengelighetbitestikleneblindtarmblodblod-hjerne-barrierenblodcellerblodplaterblodsukkerblodtransfusjonblodtrykkblodtrykksrefleksenblæretransportBrocas senterbruskforbindelserbruskvevbrystmelkbrystmusklerbuegangenebukspyttbukspyttkjertelenbulbus olfactoriusbursacanales semicircularescelledelingcelleforbindelsercellekjernecellekommunikasjoncellemembranencelleåndingcerebrospinalvæskechorioideacircumflexCNScochleacollumcollum femoriscoloncorneacorpuscorpus ciliarecorpus vitreumcortex cerebriCSFcupulacyanosecytokinercytoplasmacytosincytoskjelettetcytosolcytotoksiske cellercøkumD-dimerdefekasjonsprosessden blinde flekkden gule flekkendendritterdeoksyribonukleinsyredepolariseringdermatomdesmosomerdet cortiske organdiafragmadiapedesediastolediencefalondiffusjondiploide cellerdisakkariderDNAdopaminductus semicircularesduodenumdura materdyspnédødvolumEDVEFeffektorejeksjonsfraksjonEKGeksentrisk arbeideksitatoriske synapserekskresjoneksocytoseeksonekspektoratekspirasjonekspiratorisk reservevolumekstensjoneksternaelektrisk gradientelektrontransportkjedenemulgatorendediastolisk volumendesystolisk volumendetarmendocytoseendokardendokrin reguleringendokrine cellerendokrine pancreasendokrine systemendolymfeendomysiumenhancereenteriske nervesystemetependymcellerepigastrietepiglottisepilepsiepimysiumepitelvevEPOerytrocytterytropoieseerytropoietinESVfagocytosefagocytterfeberfenotypefettfettvevFEV1fibrinolysefibrøse forbindelserfleksjonflerumettet fettfollikkelstimulerende hormonforankringsproteinerfordøyelseskanalenforlengede margforsert ekspiratorisk volum1fosfolipiderfotonerFrank-Starlings hjertelovfrontalbarkfrontallappenFSHfundusfyllingsgradførstepassasjemetabolismegallegalleblæragallesaltergangliongap junctionsgassutvekslinggastringenetikkgenotypeghrelinglandelglatt muskulaturgliacellerglideleddglobinglottisglukagonglukoseGLUT4glykogenolysegonadergrå substansguaningynekomastihaploide cellerhaustrahCGhemoglobinhemoglobinets metningskurvehemostasehengselleddHennemans prinsippheterozygothilus-områdethippocampushis’ bunthjernebarkenhjernebjelkenhjernebroenhjernehalvdelerhjernehinnenehjernenervenehjernestammenhjertekontraksjonhjertemuskulaturhjertethjertets egenfrekvenshjertets elektriske ledningssystemhjertets hvilerytmehomeostasehomozygothormonell reguleringhormonsystemethornhinnenhukommelsehukommelsescellerhvilemembranpotensialethvit substanshvite blodcellerhydrocele hydrolaserhyperpolariseringhypertermihyperton løsninghypofysenhypospadihypothalamushypoton løsninghørselsansenileumimmunimmuniseringimmunitetindre øretinfeksjoninflammasjoninhibitoriske synapserinspirasjoninspiratorisk reservevoluminsulininterferonerinterleukinerintermediære filamenterintimaintronionekanaleririsisometrisk arbeidisotone løsningjernkalsitriolkapillærerkarbohydraterkardiakarkontraksjonkatekolaminkjemisk gradientkjemokinerkjemotaksekjønnsbundet arvegangkjønnscellerkjønnshormonerklitoriskneleddetknoklerkoagulasjonkodonkolecystokininkolskomplementfaktorerkomplementsystemetkomplementære baserkondylleddkonjugeringkonsentrisk arbeidkontraksjonkontraktilitetkontraktilt vevkoronararterienekorpuskortisolkromosomkromosomfeilkrøskuleleddkvinnelige kjønnshormonerkymotrypsinLADlangerhanske øycellerlangsynthetlarynxlateralLCXleddleddbruskleddkapselleddspalteleft anterior descendinglemniscus medialisleptinleukocytterleverlichen sclerosusligandlikevektsorganenelikevektsreseptorerlikevektssansenlillehjernenlipaselipolyseluktecelleluktehårluktekolbenluktenervenluktesansenlungekretsløpetlungenelungevolumluteiniserende hormonlymfatiske organerlymfelymfekarlymfeknuterlymfesystemetlymfocytterlymfoid rekkelymfoide organerlysozymmakrofagermarghulemastcellermediamedialmediastinummedulla oblongatamegakaryocyttermeiosemelatoninmellomhjernenmellomøretmeniskmenstruasjonssyklusmesencefalonmessenger-RNAmettet fettMHC-molekylermidthjernenmikrogliamikrotottermikrotubulimikrovillimiltminuttvolummitokondriell arvegangmitokondriermitosemonosakkaridermotilitetmotorisk barkmotorisk funksjonmotoriske enhetermotoriske systemetmotorproteinmRNAmucinproduserende cellermuskarin-reseptorermuskel-vene-pumpenmuskelfiberbuntermuskelkontraksjonmuskelproteinermuskelvevmutasjonermyelinmyeliniserte aksonermyelogen rekkemyokardmyosinmyotomnatrium-kaliumpumpenaturlig drepercellenefronnegativ feedbacknerveimpulsnerveledningnerverotnervestyrt reguleringnervesystemetnervevevnervus vagusnetthinnennevroendokrin reguleringnevromuskulær synapsenevronnevrotransmitterNK-cellenoradrenalinnukleotidnærsynthetnøytrofile granulocytteroksidativ fosforyleringoksipitallappenoksygenmetningoksytocinoligodendrocyttomega-3-fettsyrerorganellerosmoseosmotisk trykkotolittorganeneoverflatespenningpancreaspapelparafimoseparakrin reguleringparasympatikusparathyreoideaparathyreoideahormonparietalcellerparietallappenpartialtrykkpassiv transportpenispenisfrakturperfusjonperifere nervesystemperikardperimysiumperiostperistaltikkperitoneumPeritubulær kapillærperkusjonpharynxpia materpivotleddplasmaplasmacellerplasmaproteinerplateepitelplatepluggdannelsepleuraplexus choroideuspnspolysakkariderponsportvenenpost-transkripsjonell modifikasjonposteriorpostsynaptisk membranpre-mRNApreloadpresynaptisk membranpriapismeprimæraktiv transportprimærresponsproenzymerprogesteronprolaktinpronasjonpropriosepsjonssansprostataproteaserproteinproteinfilamenterprovoserte krampeanfallpulmonalklaffenpunktmutasjonpupillenpurkinjefibrepusspylorusRanviersk innsnøringrefleksrefleksbuereflekssenterrefraktærperioderegnbuehinnenrektumreninrepolariseringreseptive feltreseptorproteinerrespirasjonsmusklerrespirasjonsreguleringrespirasjonssenteretrespiratorisk epitelrestvolumretikulocytterretinaretrograd bølgeRh-immuniseringrhesussystemetRNA-polymeraserotasjonsbevegelserryggmargenryggsøylenryggvirvlerrøde blodcellerrørknokkelsacculussadelleddsaltersarkolemmasarkomersatellittcellerSchwannske cellersclerascrotumsegmenteringsbevegelserseilklaffenesekresjonsekretinsekundæraktiv transportsekundærresponssemilunar-klaffenesemipermeabel membransenehinnesensorisk barksensoriske reseptorersensoriske systemsentralfurensentralnervesystemetsepsissignaloverføringsilenceresirkulasjonsreguleringsirkulasjonssystemetsitronsyresyklusenskjelettetskjoldbruskkjertelenslagvolumsmakskvalitetersmaksløkersmaksporersmakssansensmertesneglehusetspenningsstyrte kalsiumkanalerspenningsstyrte kanalerspesifikke immunforsvaretspinalganglionspinalnerversporstofferspråkforståelsespråkproduksjonspyttkjertlerstamcellerstarlingmekanismenstaversteroiderstimulusstorhjernenstrålelegemetstøttevevsubaraknoidalrommetsupinasjonsurfaktantSVsylinderepitelsympatikussynapsersynapsespaltesynovialleddsynsbanenesynsbarksynsfeltsynsnervensynsreseptorersystemkretsløpetsystolesædblærersædcellerT-angrepscelleT-hjelpecelletaeniaetappertarmfoldertarmtottertemporal rekrutteringtemporallappentestiklenetestisretensjontestistorsjontestosteronthalamusthyminthyreoideathyreoideastimulerende hormontidevolumtight junctionstilbaketrekningsreflekstinningbeinettotal lungekapasitettotal perifer motstandtranskripsjontranslasjonWernickes områdeWillis’ sirkelytre øretZ-skivezona fasciculatazona glomerulosazona reticularisøretøretrompetenøsofagusøstrogenøyemuskleneøyets lysbrytende medier


Protein som kan bevege seg langs et molekyl ved å forbruke ATP. Myosin er et eksempel på et motorprotein.